95
|
Chem Impex International
l tyr L Tyr, supplied by Chem Impex International, used in various techniques. Bioz Stars score: 95/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/l tyr/product/Chem Impex International Average 95 stars, based on 1 article reviews
l tyr - by Bioz Stars,
2026-03
95/100 stars
|
Buy from Supplier |
90
|
CEM Corporation
liberty 12-channel automated microwave peptide synthesizer Liberty 12 Channel Automated Microwave Peptide Synthesizer, supplied by CEM Corporation, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/liberty 12-channel automated microwave peptide synthesizer/product/CEM Corporation Average 90 stars, based on 1 article reviews
liberty 12-channel automated microwave peptide synthesizer - by Bioz Stars,
2026-03
90/100 stars
|
Buy from Supplier |
90
|
Peptron Inc
hiv-1 nl4-3 tat-derived peptides Hiv 1 Nl4 3 Tat Derived Peptides, supplied by Peptron Inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/hiv-1 nl4-3 tat-derived peptides/product/Peptron Inc Average 90 stars, based on 1 article reviews
hiv-1 nl4-3 tat-derived peptides - by Bioz Stars,
2026-03
90/100 stars
|
Buy from Supplier |
90
|
GenScript corporation
synthesized peptide np1 Synthesized Peptide Np1, supplied by GenScript corporation, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/synthesized peptide np1/product/GenScript corporation Average 90 stars, based on 1 article reviews
synthesized peptide np1 - by Bioz Stars,
2026-03
90/100 stars
|
Buy from Supplier |
90
|
Watanabe Chemical
peptide synthesizer kms-3 Peptide Synthesizer Kms 3, supplied by Watanabe Chemical, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/peptide synthesizer kms-3/product/Watanabe Chemical Average 90 stars, based on 1 article reviews
peptide synthesizer kms-3 - by Bioz Stars,
2026-03
90/100 stars
|
Buy from Supplier |
90
|
Peptide Specialty Laboratories
25 µm custom-synthesized crgd-thiol peptide, (cyclo [arg– gly–asp]–d–phe–lys-[peg]18-[cys]3 25 µm Custom Synthesized Crgd Thiol Peptide, (Cyclo [Arg– Gly–Asp]–D–Phe–Lys [Peg]18 [Cys]3, supplied by Peptide Specialty Laboratories, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/25 µm custom-synthesized crgd-thiol peptide, (cyclo [arg– gly–asp]–d–phe–lys-[peg]18-[cys]3/product/Peptide Specialty Laboratories Average 90 stars, based on 1 article reviews
25 µm custom-synthesized crgd-thiol peptide, (cyclo [arg– gly–asp]–d–phe–lys-[peg]18-[cys]3 - by Bioz Stars,
2026-03
90/100 stars
|
Buy from Supplier |
90
|
Kokusan Chemical Co Ltd
peptide-synthesizing shaking apparatus kms-3 Peptide Synthesizing Shaking Apparatus Kms 3, supplied by Kokusan Chemical Co Ltd, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/peptide-synthesizing shaking apparatus kms-3/product/Kokusan Chemical Co Ltd Average 90 stars, based on 1 article reviews
peptide-synthesizing shaking apparatus kms-3 - by Bioz Stars,
2026-03
90/100 stars
|
Buy from Supplier |
90
|
Biomer Technology Ltd
a peptide of 32 aa corresponding to the predicted coiled-coil domain of mouse ric-3 (137ahrkitnfelvqlqeklketeeameklinrvg168) was synthesized A Peptide Of 32 Aa Corresponding To The Predicted Coiled Coil Domain Of Mouse Ric 3 (137ahrkitnfelvqlqeklketeeameklinrvg168) Was Synthesized, supplied by Biomer Technology Ltd, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/a peptide of 32 aa corresponding to the predicted coiled-coil domain of mouse ric-3 (137ahrkitnfelvqlqeklketeeameklinrvg168) was synthesized/product/Biomer Technology Ltd Average 90 stars, based on 1 article reviews
a peptide of 32 aa corresponding to the predicted coiled-coil domain of mouse ric-3 (137ahrkitnfelvqlqeklketeeameklinrvg168) was synthesized - by Bioz Stars,
2026-03
90/100 stars
|
Buy from Supplier |
90
|
BIOTAGE
96-channel syro ii automated peptide synthesizer 96 Channel Syro Ii Automated Peptide Synthesizer, supplied by BIOTAGE, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/96-channel syro ii automated peptide synthesizer/product/BIOTAGE Average 90 stars, based on 1 article reviews
96-channel syro ii automated peptide synthesizer - by Bioz Stars,
2026-03
90/100 stars
|
Buy from Supplier |
90
|
Advanced ChemTech
40-channel automated act440 peptide synthesizer 40 Channel Automated Act440 Peptide Synthesizer, supplied by Advanced ChemTech, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/40-channel automated act440 peptide synthesizer/product/Advanced ChemTech Average 90 stars, based on 1 article reviews
40-channel automated act440 peptide synthesizer - by Bioz Stars,
2026-03
90/100 stars
|
Buy from Supplier |
90
|
ChinaPeptides
12-channel semi-automatic peptide synthesizer 12 Channel Semi Automatic Peptide Synthesizer, supplied by ChinaPeptides, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/12-channel semi-automatic peptide synthesizer/product/ChinaPeptides Average 90 stars, based on 1 article reviews
12-channel semi-automatic peptide synthesizer - by Bioz Stars,
2026-03
90/100 stars
|
Buy from Supplier |
90
|
ChinaPeptides
twelve-channel semi-automated peptide synthesizer Twelve Channel Semi Automated Peptide Synthesizer, supplied by ChinaPeptides, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/twelve-channel semi-automated peptide synthesizer/product/ChinaPeptides Average 90 stars, based on 1 article reviews
twelve-channel semi-automated peptide synthesizer - by Bioz Stars,
2026-03
90/100 stars
|
Buy from Supplier |