3 channel peptide synthesizer Search Results


95
Chem Impex International l tyr
L Tyr, supplied by Chem Impex International, used in various techniques. Bioz Stars score: 95/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/l tyr/product/Chem Impex International
Average 95 stars, based on 1 article reviews
l tyr - by Bioz Stars, 2026-03
95/100 stars
  Buy from Supplier

90
CEM Corporation liberty 12-channel automated microwave peptide synthesizer
Liberty 12 Channel Automated Microwave Peptide Synthesizer, supplied by CEM Corporation, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/liberty 12-channel automated microwave peptide synthesizer/product/CEM Corporation
Average 90 stars, based on 1 article reviews
liberty 12-channel automated microwave peptide synthesizer - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

90
Peptron Inc hiv-1 nl4-3 tat-derived peptides
Hiv 1 Nl4 3 Tat Derived Peptides, supplied by Peptron Inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/hiv-1 nl4-3 tat-derived peptides/product/Peptron Inc
Average 90 stars, based on 1 article reviews
hiv-1 nl4-3 tat-derived peptides - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

90
GenScript corporation synthesized peptide np1
Synthesized Peptide Np1, supplied by GenScript corporation, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/synthesized peptide np1/product/GenScript corporation
Average 90 stars, based on 1 article reviews
synthesized peptide np1 - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

90
Watanabe Chemical peptide synthesizer kms-3
Peptide Synthesizer Kms 3, supplied by Watanabe Chemical, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/peptide synthesizer kms-3/product/Watanabe Chemical
Average 90 stars, based on 1 article reviews
peptide synthesizer kms-3 - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

90
Peptide Specialty Laboratories 25 µm custom-synthesized crgd-thiol peptide, (cyclo [arg– gly–asp]–d–phe–lys-[peg]18-[cys]3
25 µm Custom Synthesized Crgd Thiol Peptide, (Cyclo [Arg– Gly–Asp]–D–Phe–Lys [Peg]18 [Cys]3, supplied by Peptide Specialty Laboratories, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/25 µm custom-synthesized crgd-thiol peptide, (cyclo [arg– gly–asp]–d–phe–lys-[peg]18-[cys]3/product/Peptide Specialty Laboratories
Average 90 stars, based on 1 article reviews
25 µm custom-synthesized crgd-thiol peptide, (cyclo [arg– gly–asp]–d–phe–lys-[peg]18-[cys]3 - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

90
Kokusan Chemical Co Ltd peptide-synthesizing shaking apparatus kms-3
Peptide Synthesizing Shaking Apparatus Kms 3, supplied by Kokusan Chemical Co Ltd, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/peptide-synthesizing shaking apparatus kms-3/product/Kokusan Chemical Co Ltd
Average 90 stars, based on 1 article reviews
peptide-synthesizing shaking apparatus kms-3 - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

90
Biomer Technology Ltd a peptide of 32 aa corresponding to the predicted coiled-coil domain of mouse ric-3 (137ahrkitnfelvqlqeklketeeameklinrvg168) was synthesized
A Peptide Of 32 Aa Corresponding To The Predicted Coiled Coil Domain Of Mouse Ric 3 (137ahrkitnfelvqlqeklketeeameklinrvg168) Was Synthesized, supplied by Biomer Technology Ltd, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/a peptide of 32 aa corresponding to the predicted coiled-coil domain of mouse ric-3 (137ahrkitnfelvqlqeklketeeameklinrvg168) was synthesized/product/Biomer Technology Ltd
Average 90 stars, based on 1 article reviews
a peptide of 32 aa corresponding to the predicted coiled-coil domain of mouse ric-3 (137ahrkitnfelvqlqeklketeeameklinrvg168) was synthesized - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

90
BIOTAGE 96-channel syro ii automated peptide synthesizer
96 Channel Syro Ii Automated Peptide Synthesizer, supplied by BIOTAGE, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/96-channel syro ii automated peptide synthesizer/product/BIOTAGE
Average 90 stars, based on 1 article reviews
96-channel syro ii automated peptide synthesizer - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

90
Advanced ChemTech 40-channel automated act440 peptide synthesizer
40 Channel Automated Act440 Peptide Synthesizer, supplied by Advanced ChemTech, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/40-channel automated act440 peptide synthesizer/product/Advanced ChemTech
Average 90 stars, based on 1 article reviews
40-channel automated act440 peptide synthesizer - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

90
ChinaPeptides 12-channel semi-automatic peptide synthesizer
12 Channel Semi Automatic Peptide Synthesizer, supplied by ChinaPeptides, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/12-channel semi-automatic peptide synthesizer/product/ChinaPeptides
Average 90 stars, based on 1 article reviews
12-channel semi-automatic peptide synthesizer - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

90
ChinaPeptides twelve-channel semi-automated peptide synthesizer
Twelve Channel Semi Automated Peptide Synthesizer, supplied by ChinaPeptides, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/twelve-channel semi-automated peptide synthesizer/product/ChinaPeptides
Average 90 stars, based on 1 article reviews
twelve-channel semi-automated peptide synthesizer - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

Image Search Results